DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and grass

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:287 Identity:88/287 - (30%)
Similarity:136/287 - (47%) Gaps:58/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DSKCIALFR-----------IRVIGGQNARRT--PWMAYL----IRDNRFACGGSLIAYRFVLTA 73
            :||.::||:           .||..|...:.:  ||||.|    ..::||.|||::|:.|::|||
  Fly    97 NSKVMSLFKDENFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTA 161

  Fly    74 AHCTK--INDNLFVRLGEYDSSRTTDGQTRSYR------VVSIYRHKNYI----DFRN--HDIAV 124
            |||..  .||...:||||:..|...|.:.:..:      ||::...|:.|    |.|:  ||||:
  Fly   162 AHCVHGLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIAL 226

  Fly   125 LKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQ-----------MAHYYKMPTTLQE 178
            |||:|.|.:..:|:|||:.:...|:..|..|..:.:||||.           .|:....|.:...
  Fly   227 LKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACS 291

  Fly   179 MSLRRVRNEYCGVPSLSICC-WNPVQYACFGDSGGPLGS----LVKYGHKTIYVQFGVTNSVTGN 238
            .:.||      .||...:|. ...:|.:|.|||||||.:    |.:|..|  .|:||:.:.....
  Fly   292 QAYRR------AVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPK--MVEFGIVSQGVVT 348

  Fly   239 CDGYS---SYLDLMSYMPWLYQTLLRN 262
            |...|   .|.::..|:.|:..|:..|
  Fly   349 CGQISLPGLYTNVGEYVQWITDTMASN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 81/256 (32%)
Tryp_SPc 37..258 CDD:238113 81/259 (31%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 80/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.