DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and SPE

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:279 Identity:82/279 - (29%)
Similarity:119/279 - (42%) Gaps:55/279 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CIALFRIRVIGGQNAR--RTPWMAYLIRDNRFA------CGGSLIAYRFVLTAAHC------TKI 79
            |..||..|:.||.|..  ..|||..|.....|:      |||:|:..|:||||.||      .|.
  Fly   127 CGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKS 191

  Fly    80 NDNLF-VRLGEYDSSRTTD--GQTRSYRV-----VSIYRHK---------NYIDFRNHDIAVLKL 127
            ...|. |||||:|:....|  .|....|:     :.|...|         |.:|.|| |||:::|
  Fly   192 GAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRN-DIALVRL 255

  Fly   128 DRQVVYDAYIRPICILLNSGLQSLANSIQNFT-----LTGWG----QMAHYYKMPTTLQEMSLRR 183
            .|.|.|..|:||||:..:..:|:      ||.     :.|||    ......|:..|:...:|..
  Fly   256 KRIVSYTDYVRPICLPTDGLVQN------NFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTS 314

  Fly   184 VRNEYCG----VPSLSICCWNPVQY-ACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNC--DG 241
            .:.:|..    :....:|....:.. .|.|||||||...:..|.:.::...|||:..|..|  .|
  Fly   315 CQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKG 379

  Fly   242 YSS-YLDLMSYMPWLYQTL 259
            :.. |....:::.|:.|.|
  Fly   380 WPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 76/265 (29%)
Tryp_SPc 37..258 CDD:238113 76/268 (28%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 76/268 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.