DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG16710

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:365 Identity:90/365 - (24%)
Similarity:139/365 - (38%) Gaps:110/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLTFLVILT-----LGSYGYSQL-LDSKCIALFR------------------------------ 34
            |.::|||:.|     |....|... ||.|||:|.|                              
  Fly     7 VYISFLVLHTQLLMYLAESEYPPCNLDEKCISLARCTSLLPFLKPHNMTPAEKAVFEDRYCGYGP 71

  Fly    35 --------------------------------IRVIGGQNAR--RTPWMAYLIRDNR-------- 57
                                            .|:.||:..:  ..||||.::..:|        
  Fly    72 KGQELLDRVLICCPNMGHILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNER 136

  Fly    58 --FACGGSLIAYRFVLTAAHCTKIN--DNLFVRLGEYDSSRTTDGQTR---------SYRVVSI- 108
              ..|.||||..|:|||||||.:|.  |...|||||::.....|..|.         .:..:.: 
  Fly   137 LVSRCAGSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVD 201

  Fly   109 --YRHKNYIDFRN---HDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAH 168
              .:|::|:.|..   :|||:|:|...|.|.|.|:|||:.|:....:.:.|.....:.||| ::|
  Fly   202 LSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWG-LSH 265

  Fly   169 YYKMPTTLQEMSLRRVRNEYCGV--PSLS------ICCWN-PVQYACFGDSGGPLGSLVKYGHKT 224
            .......|.:..:.....:.|.:  |||.      ||..| .....|.|||||||.::::.|.:.
  Fly   266 KQGYSNVLLQAYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEE 330

  Fly   225 IYVQFGVTNSVTGNCDGY--SSYLDLMSYMPWLYQTLLRN 262
            .....|:|:.....| ||  ::|.....::.|:...:..|
  Fly   331 FVYLAGITSYGYSQC-GYGPAAYTKTSKFVEWILWNMYTN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 74/257 (29%)
Tryp_SPc 37..258 CDD:238113 74/260 (28%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 5/48 (10%)
Tryp_SPc 105..362 CDD:214473 74/258 (29%)
Tryp_SPc 106..362 CDD:238113 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.