DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG31199

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:303 Identity:76/303 - (25%)
Similarity:122/303 - (40%) Gaps:81/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVILTLGSYG----YSQLLDSKCIALFRIRVIGGQNARRTP----WMAYL---------IRDNRF 58
            :::|.:|.:|    .:::.|.:|.|....:::..|:....|    |:|.:         ||||  
  Fly     7 VLLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIRDN-- 69

  Fly    59 ACGGSLIAYRFVLTAAHC----TKINDNLFVRLGEYDSSR-------TTDG----QTRSYRVVSI 108
            .|.|.|::.|.||..|||    ..:.:...|.||.::.|.       .|||    .::..::..|
  Fly    70 GCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEI 134

  Fly   109 YRHKNYIDFR--NHDIAVLKLDRQVVYDAYIRPICI----LLNSGLQSLANSIQNFTLTGWGQMA 167
            ..|.:| |.|  .:.:|||.|.|.......:.|||:    |||..|.:     |.|.:.|. ::.
  Fly   135 AIHPDY-DSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVA-----QTFVVAGL-RVF 192

  Fly   168 HYYKMPTTLQEMS----------LRRVRNEYCGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGH 222
            ..:::.|.:..:|          |....|..||...      .||.|..    |.||..|.|.||
  Fly   193 EDFRLKTWVNTLSRGFCQSKVKTLVTSSNTVCGYHK------QPVAYYL----GAPLVGLQKKGH 247

  Fly   223 KT-IYVQFGV-------TNSVTGNCDGYSSYLDLMSYMPWLYQ 257
            .| .|...|:       .|.:      .||:|.:.:||.::.|
  Fly   248 VTQNYYLVGIMIDWRWENNRI------MSSFLAIRNYMDFIRQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 69/269 (26%)
Tryp_SPc 37..258 CDD:238113 70/273 (26%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 61/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.