DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG31219

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:280 Identity:83/280 - (29%)
Similarity:120/280 - (42%) Gaps:70/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ALFRIRVIGGQNARRT--PWMAYLIRDNRFA------CGGSLIAYRFVLTAAHCTK-INDNL--- 83
            :|...|::||..||..  ||||.|:..|...      |.||||..|:|||:|||.. |..:|   
  Fly    83 SLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLK 147

  Fly    84 FVRLGEYD---------SSRTTDGQ----TRSYRVVSIYRHKNYIDFRN----HDIAVLKLDRQV 131
            .|||||:|         ..|..|.|    ....::..|..|..:....|    :|||:|:|...|
  Fly   148 SVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPV 212

  Fly   132 VYDAYIRPICI-----LLNSGLQSLANSIQNFTLTGWGQ---------MAHYYKMPTTLQEMSLR 182
            .|...|.||||     ...|.|:          :.|||:         :.|.:     ::|.|:.
  Fly   213 RYRTGIMPICIPKHGFFAKSKLE----------IAGWGKTNEGQFSQVLMHGF-----IRERSIA 262

  Fly   183 --RVRNEYCGV-PSLSICC--WNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGY 242
              .:|..|..: .||.||.  ::.|. .|.|||||||  :|...:.::|:. |:|...:.||...
  Fly   263 VCALRFPYLDLNQSLQICAGGYDGVD-TCQGDSGGPL--MVTMDNSSVYLA-GITTYGSKNCGQI 323

  Fly   243 ---SSYLDLMSYMPWLYQTL 259
               ..|....:::||:...|
  Fly   324 GIPGIYTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 79/268 (29%)
Tryp_SPc 37..258 CDD:238113 80/271 (30%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 80/269 (30%)
Tryp_SPc 90..342 CDD:238113 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.