DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG5255

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:276 Identity:80/276 - (28%)
Similarity:123/276 - (44%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARR--TPWMAYL--IRDNRFACGGSLIA 66
            :||..|.::...|...||:|...  ...:.|::||:.|..  .|:...|  |.....:|||::|.
  Fly     1 MLLILLPLVLFTSSAASQILYPP--QYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIID 63

  Fly    67 YRFVLTAAHCTKINDNLFVRL--GEYDSSRTTDGQTRSYRVVSIYRHKNYI--DFRNHDIAVLKL 127
            .|:::||||||:.......|:  |..|..:   ..::.|....|..|.||.  .:|| |||:|.|
  Fly    64 ERWIITAAHCTRGRQATAFRVLTGTQDLHQ---NGSKYYYPDRIVEHSNYAPRKYRN-DIALLHL 124

  Fly   128 DRQVVYDAYIRPICI---LLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC 189
            :..:|:|...:|:.:   .|..|.:.|        |||||.::....:|..||.:.:..|..|.|
  Fly   125 NESIVFDNATQPVELDHEALVPGSRLL--------LTGWGTLSLGGDVPARLQSLEVNYVPFEQC 181

  Fly   190 --------GVPSLSICCWNPV-QYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSY 245
                    .|....:|.:|.. :.||.||||||   ||..|.....|.:|:. ...|..|.::| 
  Fly   182 RAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGP---LVHNGKLVALVNWGLP-CAKGYPDAHAS- 241

  Fly   246 LDLMSYMPWLYQTLLR 261
               :||    |...:|
  Fly   242 ---ISY----YHDFIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 71/237 (30%)
Tryp_SPc 37..258 CDD:238113 71/240 (30%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 72/243 (30%)
Tryp_SPc 30..252 CDD:238113 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.