DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG4053

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:293 Identity:77/293 - (26%)
Similarity:121/293 - (41%) Gaps:79/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLTFLVILTLGS---YGYSQLLDSKCIALFRIRVIGGQNAR----------RTPWMAYLIRDNR 57
            |.|:.:.:|.||:   ....:.||::  .|...|::|||.|.          :|.|..::     
  Fly     3 VRLSLIWLLLLGTSIDVTRGKRLDNR--KLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHI----- 60

  Fly    58 FACGGSLIAYRFVLTAAHCT---KINDNLFVRLGEYDSSRTTDGQTR---------SYRVVSIYR 110
              |.|.::..:::|||.||.   .|.| |.:.:|..|  |...|||.         .|.:..:| 
  Fly    61 --CSGVILNEQWILTAGHCALDFSIED-LRIIVGTND--RLEPGQTLFPDEALVHCLYDIPYVY- 119

  Fly   111 HKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTT 175
                    |:|||::.::..::::...:   |:..|..|..|.|  ..||||||.....|.....
  Fly   120 --------NNDIALIHVNESIIFNDRTQ---IVELSREQPPAGS--TVTLTGWGAPESSYPTVQY 171

  Fly   176 LQEMSLRRVRNEYC--------GVPSLSICCW-NPVQYACFGDSGGPL---GSLVKYGHKTIYVQ 228
            ||.::|..:.:|.|        |:....||.: ...:.||.|||||||   |.||          
  Fly   172 LQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLV---------- 226

  Fly   229 FGVTNSVTGNCDGY---SSYLDLMSYMPWLYQT 258
             |:.|  .|...|.   ..|.:.:.|..|:.:|
  Fly   227 -GLVN--WGRACGVGMPDMYANTVYYQDWIRRT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 67/254 (26%)
Tryp_SPc 37..258 CDD:238113 67/257 (26%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 67/255 (26%)
Tryp_SPc 35..256 CDD:238113 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.