DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG3505

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:272 Identity:72/272 - (26%)
Similarity:110/272 - (40%) Gaps:85/272 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RRTPWMAYL--IRDNR---FACGGSLIAYRFVLTAAHCT--KINDNL---FVRLGEYDSSRTTDG 98
            |..||:|.:  .|.|:   .||||.||:.|:|||||||.  ....||   .|||||:|:|...|.
  Fly   116 REFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDC 180

  Fly    99 QTRS----------YRVVSI--------YRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLN 145
            |...          |:.::|        |...:....  :|||:::|......:.:::||| |.|
  Fly   181 QYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQI--NDIALVRLASPAKLNDFVQPIC-LPN 242

  Fly   146 SGLQSLANSIQNFT--LTGWGQMAHYYKMPTTLQEMSLRRVRNEYCGVPSLSIC----------- 197
            ..|:  |:.:::..  :.||             |..|.:|:|..|..:.|:..|           
  Fly   243 KQLR--ADELEDLVTEVAGW-------------QASSSQRMRKGYVTISSIEECQRKYASQQLRI 292

  Fly   198 -----CWNPVQYACFGDSGGP----------LGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLD 247
                 |.......|:|::|||          ||.||.:|...           ..|.|....|..
  Fly   293 QASKLCGLTNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVP-----------CPNPDWPDVYTR 346

  Fly   248 LMSYMPWLYQTL 259
            :.||:.|::.:|
  Fly   347 VASYIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 70/265 (26%)
Tryp_SPc 37..258 CDD:238113 71/269 (26%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 71/268 (26%)
Tryp_SPc 111..354 CDD:214473 70/266 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.