DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG31326

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:255 Identity:67/255 - (26%)
Similarity:110/255 - (43%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGGQNARR--TPWMAYLI--RDNR---FACGGSLIAYRFVLTAAHCTKI------NDNLFVRLG 88
            :..|::.:|  .||:..:.  |::.   |.|||:||:...||:||||.:.      ...|.|.||
  Fly   274 IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLG 338

  Fly    89 EYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLAN 153
            ....:..:||:.|....:.|:.:..:..|...|:|:::||..|.|..||.|||:...|....|..
  Fly   339 RNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQ 403

  Fly   154 SIQNFTLTGWGQMAHYYKMPTTLQEMS----LRRVRNEYCGV--------PSLSICCWNPVQYAC 206
            .:::: :.|||.    .:..|...|:|    |..|....|.:        || |:|........|
  Fly   404 GLKSY-VAGWGP----DETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPS-SLCAKKTGAGPC 462

  Fly   207 FGDSGGPLGSLVKYGHKTIYV-----QFGVTNSVTGNCD--GYSSYLDLMSYMPWLYQTL 259
            ..|.||||    ....:.::|     ..||.|.....|:  ..|.:.|:..::.|:.|.:
  Fly   463 ASDGGGPL----MLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQKM 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 65/248 (26%)
Tryp_SPc 37..258 CDD:238113 66/252 (26%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 66/249 (27%)
Tryp_SPc 277..514 CDD:214473 65/246 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.