DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG8870

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:342 Identity:87/342 - (25%)
Similarity:122/342 - (35%) Gaps:99/342 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLTFLVILTLGSYGYSQLLDSKCIAL------------FRIRVIG-------------------- 39
            ||...:||...|.|.....|::|:.|            .|..:||                    
  Fly    10 LLMLQIILVPYSNGAGCQFDTECVNLDKCPRTRAVMNSSRKNIIGLRRCGTNKVCCPKWETYLPH 74

  Fly    40 ---GQNARRT-----------PWMAYLIRDNRF--------ACGGSLIAYRFVLTAAHCTK--IN 80
               ||:.|:.           ||||.|:..|:.        .||||||...:|||||||.:  ..
  Fly    75 DTCGQSRRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFM 139

  Fly    81 DNLF----VRLGEYDSSRTTD----GQTRSY-------RVVSIYRHKNYIDFRN--HDIAVLKLD 128
            |..:    |||||:::|...|    ...|.|       .|..|..|:.:...|.  :|||:::|.
  Fly   140 DYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLK 204

  Fly   129 RQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRR----VRNEYC 189
            ..|.|...|:|||:   ...|.||...:.|..:||..|.........|:.....|    .::.|.
  Fly   205 FPVRYTRAIQPICL---PRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKSNYD 266

  Fly   190 GVPSLSICC-------WNPVQYACFGDSGGPLGSLVKYGHKTI-----YVQFGVTNSVTGNCDGY 242
            ......||.       .:|      |||||||...|..|..|:     .:.:|....|...|.. 
  Fly   267 FNLGSQICAGGLDGNDTSP------GDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKP- 324

  Fly   243 SSYLDLMSYMPWLYQTL 259
            :.|.....:..|:...|
  Fly   325 AFYTKTSYFFEWIKSKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 75/294 (26%)
Tryp_SPc 37..258 CDD:238113 76/297 (26%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 71/256 (28%)
Tryp_SPc 93..337 CDD:214473 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.