DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and snk

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:256 Identity:74/256 - (28%)
Similarity:112/256 - (43%) Gaps:51/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGGQNARR--TPWMAYL---------IRDNRFACGGSLIAYRFVLTAAHC----TKINDNLFVR 86
            ::||...|.  .|.||.|         .:|.::.|||:|::..:|||||||    :|..|  .||
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPD--MVR 248

  Fly    87 LGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRN----HDIAVLKLDRQVVYDAYIRPICILLNSG 147
            ||....:.|:..| :..:::.|..|..|   |:    ||||:|||.|:|.:...:||.|:.....
  Fly   249 LGARQLNETSATQ-QDIKILIIVLHPKY---RSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPE 309

  Fly   148 LQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC------------GVPSLSICC-W 199
            ||     |......|||:..........|:::.|..|....|            |:.....|. :
  Fly   310 LQ-----IPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGY 369

  Fly   200 NP-VQYACFGDSGGPLGSLVKYGHKTIYVQFGVTN----SVTGNCDGYSSYLDLMSYMPWL 255
            .| .:..|.||||||:.:|:...:...:| .|:|:    ....|..|.  |..|.||:.|:
  Fly   370 LPGGRDTCQGDSGGPIHALLPEYNCVAFV-VGITSFGKFCAAPNAPGV--YTRLYSYLDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 73/253 (29%)
Tryp_SPc 37..258 CDD:238113 74/256 (29%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 74/256 (29%)
Tryp_SPc 186..427 CDD:214473 73/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.