DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and MP1

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:275 Identity:81/275 - (29%)
Similarity:118/275 - (42%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CIALFRIRVIGGQNA--RRTPWMAYL-------IRDNRFACGGSLIAYRFVLTAAHCTKINDNLF 84
            |...|..||:||...  |..||||.:       ::.:.  ||||||.:|:|||||||.....:.:
  Fly   130 CGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHH--CGGSLINHRYVLTAAHCVSAIPSDW 192

  Fly    85 ----VRLGEYDSSRTTD---GQTR---------SYRVVSIYRHKNYI-DFRN--HDIAVLKLDRQ 130
                |||||:|:|...|   |:..         .|.|.....|..|. :.|:  :|||:|:|..:
  Fly   193 ELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDE 257

  Fly   131 VVYDAYIRPICILLNSGLQSLANSIQNFTL------TGWGQMAHYY----KMPTTLQEMSLRRVR 185
            |.|..:|.|:|      |.:||:...|..|      .|||:....:    |:...|..:......
  Fly   258 VQYSDFILPVC------LPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECN 316

  Fly   186 NEYC----GVPSLSICCWNPVQY-ACFGDSGGPLGSLVKY--GHKTIYVQFGVTNSVTGNC--DG 241
            ..|.    .|.:..:|....... :|.||||||| .|..|  |:...|:. ||.:.....|  .|
  Fly   317 QRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPL-LLEDYSNGNSNYYIA-GVVSYGPTPCGLKG 379

  Fly   242 YSS-YLDLMSYMPWL 255
            :.. |..:.:|:.|:
  Fly   380 WPGVYTRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 78/265 (29%)
Tryp_SPc 37..258 CDD:238113 78/267 (29%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 78/266 (29%)
Tryp_SPc 138..397 CDD:238113 78/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.