DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG14088

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:264 Identity:73/264 - (27%)
Similarity:116/264 - (43%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARRT--------PWMAYLIRDNRFACG 61
            :.:||.|:|...|: |.:|.|.:.|            ..||.        ||.|.|....|....
  Fly     8 VAVLTSLLIFLSGT-GSAQFLGNIC------------GERRDGLSPDIVGPWTAILHHFGRIVGV 59

  Fly    62 GSLIAYRFVLTAAHCTKINDNLFV---RLGEYDSSRTTDGQTRSYRVVSIYRHKNY-IDFRNHDI 122
            |:||..||:||..||   .|::.|   |||||  .|........:.|.:.:.:.|: .:.:.:::
  Fly    60 GTLIHERFILTDVHC---GDSIGVIRARLGEY--GRIGSELAEDHIVAAFFSNANFNPETQANNM 119

  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNE 187
            .::||.|.|||..:|.|:|||::|.:|:.|:.:..|..|.|   .:..|.|....:..:|  ..:
  Fly   120 GLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTW---KNSDKSPMLRSKTVIR--MPQ 179

  Fly   188 YCG-VPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSY 251
            .|| :.....|..:....:|...||..|...:.|......|.||:.|||...|....:|.|::..
  Fly   180 ACGKLDHGQFCAGHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQL 244

  Fly   252 MPWL 255
            ..|:
  Fly   245 HQWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 63/230 (27%)
Tryp_SPc 37..258 CDD:238113 64/232 (28%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 62/217 (29%)
Tryp_SPc 42..248 CDD:214473 61/215 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.