DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG7542

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:241 Identity:65/241 - (26%)
Similarity:110/241 - (45%) Gaps:38/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GQNARRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYD-SSRTTDGQTR-S 102
            |.|.....|..:        |||:||::.:::|||||....:::.|.||..: ...:.:||.| .
  Fly    43 GLNVSFGNWSTW--------CGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIM 99

  Fly   103 YRVVSIYRHKNYI-DFRNHDIAVLKLDRQVVYDAYIRPICI--LLNSGLQSLANSIQNFTLTGWG 164
            .....|..|.||: ....:||::::|...|.:...||...:  .|| |......||:.|. :|||
  Fly   100 VEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLN-GQFPTYESIRAFA-SGWG 162

  Fly   165 Q----------MAHYYKMPTTLQEMSLRRVRNEYCGVPSLSICCWNPV--QYACFGDSGGPLGSL 217
            :          :..|.:||  :...||.|:  .:.|..|..:.|.:..  :..|.|||||||  :
  Fly   163 RESDASDSVSPVLRYVEMP--IMPHSLCRM--YWSGAVSEKMICMSTTSGKSTCHGDSGGPL--V 221

  Fly   218 VKYGHKTIYVQFGVTNSVTG-NCD-GYSS-YLDLMSYMPWLYQTLL 260
            .|.|:.:..:  |.|:..|. .|. |:.: :..:.||:.|:...::
  Fly   222 YKQGNSSYLI--GSTSFGTSMGCQVGFPAVFTRISSYLDWILNHII 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 64/233 (27%)
Tryp_SPc 37..258 CDD:238113 65/237 (27%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 65/237 (27%)
Tryp_SPc 27..260 CDD:214473 64/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.