DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG18179

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:277 Identity:76/277 - (27%)
Similarity:119/277 - (42%) Gaps:45/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLLTFLVILTL--GSYGYSQ--LLDSKCIAL-FRIRVIGGQNA--RRTPW-MAYLIR---DNRF 58
            :.|||..|.|.:  .|.|:::  ||....|:. ...|::.|..|  .:.|: :..|||   .|..
  Fly     3 LFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSA 67

  Fly    59 ACG-GSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTR-SYRVVSIYRHKNYIDFRNHD 121
            |.| |::||..::||||||...:   :|.: .|.|:...:|..| |.|..:...|.|:......|
  Fly    68 AVGAGTIIASDWILTAAHCLTTD---YVEI-HYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGRD 128

  Fly   122 IAVLKLDRQVVYDAYIRPICILLNS-GLQSLANSIQNFTLT-----GWGQMAHYYKMPTTLQEMS 180
            |.:::.......|        |:|. .|.|.:.....|..|     |||.|.: ..:...||.|.
  Fly   129 IGLIRTPSVGFTD--------LINKVALPSFSEESDRFVDTWCVACGWGGMDN-GNLADWLQCMD 184

  Fly   181 LRRVRNEYC-----GVPSLSICC-WNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNC 239
            ::.:.|..|     .|.|..:|. ....:.:|.||||||   ||.:.:..:   .||....:.:|
  Fly   185 VQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGP---LVTHDNARL---VGVITFGSVDC 243

  Fly   240 -DGYSSYLDLMSYMPWL 255
             .|.|.|..:..|:.|:
  Fly   244 HSGPSGYTRVTDYLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 65/238 (27%)
Tryp_SPc 37..258 CDD:238113 65/240 (27%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 65/239 (27%)
Tryp_SPc 40..263 CDD:238113 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.