DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG33465

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:279 Identity:87/279 - (31%)
Similarity:127/279 - (45%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIG-GQNARRT-PWMAYLIRDNRFACGGSLIAYR 68
            ||...|:.|.| ..|.:||||.||........|. ...|..| ||||.:.::|:|.|.|:|:...
  Fly     4 VLSLALIGLVL-CQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKL 67

  Fly    69 FVLTAAHCTKINDNLFVRLGEYDSSRTTDG--QTRSYRVVSIYRHKNYIDFRN----HDIAVLKL 127
            ||||||.|...:..|:|..|.|:..|....  ....|.|....:|.|   ||.    :||.:|:|
  Fly    68 FVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSN---FRPNNGVNDIGLLRL 129

  Fly   128 DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRV-------- 184
            ..:|.:.|:||||||:|:..::|.  ..:.|...||.|..       |.....:|:.        
  Fly   130 YGEVTHYAHIRPICIILDHVVKSA--PFERFEGFGWQQQG-------TEASSQVRQTVYLSQKKP 185

  Fly   185 ----RN-EYCGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS 244
                || :...:.....|..|..:..|..:||.||.:...||.|.|.||.|:.:..:..|...|.
  Fly   186 FECHRNGQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSV 250

  Fly   245 YLDLMSYMPWLYQTLLRNW 263
            |.|::::..|:|.| :||:
  Fly   251 YTDVVAFKDWIYNT-VRNF 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 70/238 (29%)
Tryp_SPc 37..258 CDD:238113 72/241 (30%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 69/229 (30%)
Tryp_SPc 46..261 CDD:214473 67/226 (30%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.