DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG10472

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:243 Identity:61/243 - (25%)
Similarity:116/243 - (47%) Gaps:32/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RVIGGQNA--RRTPWMAYL---IRDNRFACGGSLIAYRFVLTAAHCT-KINDNLFVRLGEYDSSR 94
            |:.|||.|  .:.|:...|   |......|||::|:.|:::|||||| .:...:.|.||.:|   
  Fly    46 RITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHD--- 107

  Fly    95 TTDGQTRSYRVV-----SIYRHKNYI-DFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLAN 153
            .|:.:....:::     ::..|:::| :...:||:::||...:.::.||:|..:.:.|...|...
  Fly   108 RTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYG 172

  Fly   154 SIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNE------YCGVPSLSICCWNPVQ--YACFGDS 210
            . :|...:|||:::......|.:.:.:...:.|.      |.|:.:.|..|.....  ..|.|||
  Fly   173 G-ENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDS 236

  Fly   211 GGPLGSLVKYGHKTIYVQFGVTN-SVTGNCD-GYSS-YLDLMSYMPWL 255
            ||||  ::..|..|:   .|.|: .:...|: |:.. :..:..|:.|:
  Fly   237 GGPL--VLDDGSNTL---IGATSFGIALGCEVGWPGVFTRITYYLDWI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 60/240 (25%)
Tryp_SPc 37..258 CDD:238113 60/242 (25%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 60/241 (25%)
Tryp_SPc 47..282 CDD:238113 60/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.