DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG10477

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:254 Identity:65/254 - (25%)
Similarity:109/254 - (42%) Gaps:42/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DSKCIALFRIRVIGGQN--ARRTPW---MAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFV 85
            ||..:.....|:..|..  |.:.|:   :::......:.||||:||..:|||||||||...::.:
  Fly    29 DSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTI 93

  Fly    86 RLGEYDSSRTTDGQTRSYRVVSIYRHKNY--IDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGL 148
            ..|  .:.||:....:........:|..|  ...|| ||:::|.. .|.:...|..|      .|
  Fly    94 YYG--STVRTSAKLKKKVSSSKFVQHAGYNAATLRN-DISLIKTP-SVTFTVSINKI------AL 148

  Fly   149 QSLANSI-----QNFTLTGWGQMA-HYYKMPTTLQEMSLRRVRNEYC------GVPSLSICCWNP 201
            .::|:|.     |....:|||:.: ....:.|.||....:.:.|..|      .|.:..:.|...
  Fly   149 PAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVES 213

  Fly   202 V--QYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTG-NCD--GYSSYLDLMSYMPWL 255
            :  :..|.|||||||.    ..::.|    |||:.|:. .|:  ..:.:..:.||:.|:
  Fly   214 INKKSTCQGDSGGPLA----LNNRLI----GVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 62/241 (26%)
Tryp_SPc 37..258 CDD:238113 62/243 (26%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 62/242 (26%)
Tryp_SPc 40..267 CDD:238113 62/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.