DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG12133

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:264 Identity:85/264 - (32%)
Similarity:114/264 - (43%) Gaps:53/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGGQNAR--RTPWMAYLIRDNRFA-------CGGSLIAYRFVLTAAHCTKINDNLF--VRLGEY 90
            ::||..|:  :.||...|..:...|       |.|||||.|:|||||||..:||...  |||||:
  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEH 126

  Fly    91 DSSRTTDGQTRSYRVVSIYR-------------HKNYIDFRN----HDIAVLKLDRQVVYDAYIR 138
            |:....| .|.......|:.             |:.|.. ||    :|||:|:|..:|.|...||
  Fly   127 DTENDPD-YTWLPNGAKIWAPAHVDIDVDLRVPHEQYYT-RNGRHYNDIALLRLKSRVKYTLQIR 189

  Fly   139 PICILLNSGLQSLANSIQN--FTLTGWGQMAHYYKMPT----TLQEMSLRRVRNEYCGVPSL--- 194
            ||||.  .|::...:|.:|  |.:.|||......|...    |:..||.....|.|   |:|   
  Fly   190 PICIW--PGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRY---PTLLVD 249

  Fly   195 ---SICC--WNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTG-NCDGY--SSYLDLMSY 251
               .||.  |:..... .||||.||.:.|..|....|...|:|:...| :..||  :.|....||
  Fly   250 KDIQICAMGWDGTDTG-LGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSY 313

  Fly   252 MPWL 255
            ..|:
  Fly   314 YEWI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 84/261 (32%)
Tryp_SPc 37..258 CDD:238113 85/264 (32%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 85/264 (32%)
Tryp_SPc 62..317 CDD:214473 84/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.