DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG4650

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:272 Identity:77/272 - (28%)
Similarity:125/272 - (45%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTPAIVLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARRTPWMAYL-IRDNRFACGGSL 64
            |...::.::.|:.| |...|.||.||.:|..|...::   .|...:|||||| ..:..:.|||::
  Fly     1 MDSVVIGISALLFL-LPVPGSSQYLDGRCGLLTNGKI---ANNISSPWMAYLHTSELLYVCGGTV 61

  Fly    65 IAYRFVLTAAHCTKINDNLFVRLGEY-DSSRTTDGQTRSYRVVSIYRHKNYIDFRN-HDIAVLKL 127
            |..:.||||||||:.::.|..|:||: .:....|.....|:|...:.|..|....: :|||:|.|
  Fly    62 ITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGL 126

  Fly   128 DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQE------MSLRRVRN 186
            ...:|:...||||||:..:..:...::||..:...||       :|....|      ..:||...
  Fly   127 ATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWG-------LPNDRNESDAFRITDIRRQPA 184

  Fly   187 EYC------GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGV--TNSVTGNCDGYS 243
            ..|      .:.|...|..:.....|..|...|||:::.:.:...||..|:  ||.   .|...|
  Fly   185 NMCSTLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQ---KCKRAS 246

  Fly   244 SYLDLMSYMPWL 255
            .|.|::|:..::
  Fly   247 VYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 66/234 (28%)
Tryp_SPc 37..258 CDD:238113 66/236 (28%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 66/237 (28%)
Tryp_SPc 33..258 CDD:304450 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.