DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG9377

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:253 Identity:60/253 - (23%)
Similarity:98/253 - (38%) Gaps:70/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRL--GEYDSSRTTDGQTRSYR-VVSI 108
            ||:..:...:.:.|.|:||....|:|.|||.:.::...|||  ||:|::...:.|....| ||..
  Fly   113 PWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVET 177

  Fly   109 YRHKNYIDF-RNHDIAVLKLDRQVVYD--AYIRPICILLNSGLQSLANSIQNFT---LTGW---- 163
            ..|.||... ..|:||:|.:|::..:.  ..::|||:       .....:.|::   ::||    
  Fly   178 LVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL-------PPPRIMYNYSQCYVSGWQRSD 235

  Fly   164 -GQMA------HYYKMP----TTLQEMSL---RRVRNEYCGVPSLSICCWNPVQYACFGDSGGPL 214
             |:.|      ..|.:|    .|...:||   |...|:       |:.|           :||..
  Fly   236 FGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHND-------SLLC-----------AGGDK 282

  Fly   215 GSLV--------------KYGHKTIYVQFGVTNSVTGNCDG---YSSYLDLMSYMPWL 255
            |..|              ..||...:...|:... |..|||   ...|.::..|..|:
  Fly   283 GDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTR-TARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 59/250 (24%)
Tryp_SPc 37..258 CDD:238113 60/253 (24%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 60/253 (24%)
Tryp_SPc 105..339 CDD:214473 59/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.