DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and psh

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:263 Identity:80/263 - (30%)
Similarity:108/263 - (41%) Gaps:58/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IRVIGGQ--NARRTPWMA---YLIRDNRFACGGSLIAYRFVLTAAHC--TKINDNLFVRLGEYDS 92
            |.::||.  :....|.||   |:.....|.|||||||.|||||||||  |..|...|||||..: 
  Fly   142 IHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVN- 205

  Fly    93 SRTTDGQTRSYR---VVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANS 154
               .:....||:   :.|:..|..|:..:.:|||:|:|:|.||....|||.| |........:||
  Fly   206 ---IENPDHSYQDIVIRSVKIHPQYVGNKYNDIAILELERDVVETDNIRPAC-LHTDATDPPSNS 266

  Fly   155 IQNFTLTGWGQM-------------------------AHYYKMPTTLQEMSLRRVRNEYCGVPSL 194
              .|.:.|||.:                         ..|.:.|.:::.:....:.:..|.:...
  Fly   267 --KFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQK 329

  Fly   195 SICCWNPVQYACFGDSGGPL--------GSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSY 251
            .|.      .||.|||||||        |.....|  .|...||......|.....|||||.:..
  Fly   330 LIA------DACKGDSGGPLIHELNVEDGMYTIMG--VISSGFGCATVTPGLYTRVSSYLDFIEG 386

  Fly   252 MPW 254
            :.|
  Fly   387 IVW 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 78/260 (30%)
Tryp_SPc 37..258 CDD:238113 79/261 (30%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 78/255 (31%)
Tryp_SPc 144..387 CDD:238113 78/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.