DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and Hayan

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:264 Identity:75/264 - (28%)
Similarity:110/264 - (41%) Gaps:58/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IRVIGGQNARR--TPWMAYLIRDN----RFACGGSLIAYRFVLTAAHCTKINDNL--FVRLGEYD 91
            :.::.|:...|  .|.||.:..::    .|.|||||||.|||||||||...:|:.  |||||..:
  Fly   383 VHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALN 447

  Fly    92 SSRTTDGQTRSYRVVSIYRHKNYI-DFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSI 155
            ......|. :...|:.:..|.:|. ..:.:|||:|:|.........|||.|:..:   :|...:.
  Fly   448 IENPEPGY-QDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTD---RSDPPAN 508

  Fly   156 QNFTLTGWGQM-------------------------AHYYKMPTTLQEMSLRRVRNEYCGVPSLS 195
            ..:.:.|||.|                         |.:.:.|:.  ..:|||      ||.:..
  Fly   509 YKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSA--NRTLRR------GVIASQ 565

  Fly   196 ICC--WNPVQYACFGDSGGPL--------GSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMS 250
            :|.  .|..:.||.|||||||        |:....|  .|...||......|.....||:||.:.
  Fly   566 LCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVG--VISSGFGCATKTPGLYTRVSSFLDYIE 628

  Fly   251 YMPW 254
            .:.|
  Fly   629 GIVW 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 74/261 (28%)
Tryp_SPc 37..258 CDD:238113 75/262 (29%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 74/256 (29%)
Tryp_SPc 385..630 CDD:238113 74/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.