DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG8952

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:245 Identity:66/245 - (26%)
Similarity:111/245 - (45%) Gaps:38/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RVIGGQNAR--RTPWMAYLIRD--NRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTT 96
            |::.|.:|:  :.||...|.||  :...||||:|:..:||||||||....::|:..|..|.....
  Fly    37 RIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNAN 101

  Fly    97 DGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSG-----LQSLANSIQ 156
            .....|..::.   |.:|.|..|:|:::::|...:.:.|.|:.|.::...|     :.|:|    
  Fly   102 ALNMTSNNIII---HPDYNDKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVA---- 159

  Fly   157 NFTLTGWGQMA-HYYKMPTTLQEMSLRRVRNEYC-------GVPSLSICCW---NPVQYACFGDS 210
              |:.|:|... .|.....||....:..:.|..|       .|...::|..   ......|.|||
  Fly   160 --TIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDS 222

  Fly   211 GGPLGSLVKYGHKTI--YVQFGVTNSVTGNCDGY---SSYLDLMSYMPWL 255
            |||   |:.| :|||  :.|.|:.:.|..:...|   |.|..:.|::.::
  Fly   223 GGP---LILY-NKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 66/242 (27%)
Tryp_SPc 37..258 CDD:238113 65/244 (27%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 66/243 (27%)
Tryp_SPc 38..271 CDD:238113 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.