DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG11664

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:174 Identity:55/174 - (31%)
Similarity:78/174 - (44%) Gaps:31/174 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RFACGGSLIAYRFVLTAAHCTKIN---DNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNY--ID 116
            :|...|||.:.|:|||.|||.|.|   :.|.||.|    .|....:.|..:|..:.||..:  :.
  Fly    44 QFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAG----YRWIAWEFRGKQVAGLLRHPKFSPLT 104

  Fly   117 FRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF-----TLTGWGQMAHYYKMPTTL 176
            .|| |||||::...:.:...|..|      ||.|...:..|.     .|.||..|  :...|  |
  Fly   105 LRN-DIAVLRVKAAISHSHMINYI------GLCSRPLTPLNMFAPPQELAGWNLM--HIAQP--L 158

  Fly   177 QEMSLRRVRNEYC--GVPSLS---ICCWNPV-QYACFGDSGGPL 214
            :.||::....:.|  ..|.:|   ||....: :..|:||||.||
  Fly   159 KSMSVQVEPEKNCRQWFPQISGGVICASATMGEGLCYGDSGDPL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 55/174 (32%)
Tryp_SPc 37..258 CDD:238113 55/174 (32%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 55/174 (32%)
Tryp_SPc 38..237 CDD:214473 55/174 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.