DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG33226

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:282 Identity:91/282 - (32%)
Similarity:129/282 - (45%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLTFLVILTLGSYGY--SQLLDSKCIAL---FRIRVIGGQNA--RRTPWMAYLIRDNRFACGGS 63
            :|:.|  ||.|.||..  ..|||..|:..   .|.:::||.||  :..|||..:::.....||||
  Fly    13 LLVCF--ILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGS 75

  Fly    64 LIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSY--------------RVVSIYRHKNY 114
            ||:..||||||||.. ...|.||.|.|      .|.|..|              .|..|:.|.:|
  Fly    76 LISSLFVLTAAHCHS-RYRLKVRFGRY------SGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY 133

  Fly   115 IDFRNHDIAVLKLDRQVVYDAYIRPICILLNSG---LQSLANSIQNFTLTGWGQMAHYYKMPTTL 176
            .|:.|:|||:..|.:.|.|:...||||:|..|.   |:...|.:..|.:||||: .......|.|
  Fly   134 RDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGK-TESQLTSTIL 197

  Fly   177 QEMSLRRVRNEYC--------GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTN 233
            |..||..:..::|        |.|  .||..:.....|.|||||||.:.:.:......|.||:.:
  Fly   198 QTTSLFHLDRKFCAQIFDRKIGWP--HICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIIS 260

  Fly   234 SVTGNCDGYSSYLDLMSYMPWL 255
            ....||...:.:.:::.|..|:
  Fly   261 YGAPNCREVTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 78/244 (32%)
Tryp_SPc 37..258 CDD:238113 79/246 (32%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 79/246 (32%)
Tryp_SPc 47..282 CDD:214473 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.