DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG33459

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:272 Identity:103/272 - (37%)
Similarity:145/272 - (53%) Gaps:19/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLTFLVILTLGSYGYSQLLDSKCIAL-FRIRVIGGQNAR--RTPWMAYLIRDNRFACGGSLIAYR 68
            ||...:|.....||.:.||:..|..: ||:|:.||.:|.  .|||||:|....:|.||||||...
  Fly     7 LLVSSIIANQLLYGLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSE 71

  Fly    69 FVLTAAHCT-KINDNLFVRLGEYDSSRTTDG-----QTRSYRVVSIYRHKNYIDFRNHDIAVLKL 127
            ||||||||. ....||.|||||||.:|..|.     :.|.|.|..||.|.:|.....:|||:|||
  Fly    72 FVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKL 136

  Fly   128 DRQVVYDAYIRPICILLNSGLQS---LANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC 189
            ::.|.|...|||||::|......   |.:|:::||||||| ......:...||..:|.::....|
  Fly   137 NQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWG-ATKTEPVSQVLQSANLTQIDRGTC 200

  Fly   190 ------GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDL 248
                  .|....||..:...:||.||||.||...|.:..:.|:.|.|:.:....||||.:.:.::
  Fly   201 HDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTVFTNV 265

  Fly   249 MSYMPWLYQTLL 260
            :|:..|:::|.|
  Fly   266 VSFTEWIFRTTL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 90/234 (38%)
Tryp_SPc 37..258 CDD:238113 90/237 (38%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 90/235 (38%)
Tryp_SPc 38..272 CDD:238113 89/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.