DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG33461

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:280 Identity:97/280 - (34%)
Similarity:144/280 - (51%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLTFLVILTLGSYGYSQL-LDSKCIALFRI--RVIGGQNAR--RTPWMAYLIRDNRFACGGSLIA 66
            ::.:|.:..||.:|.|.: |:..|..:.|:  ::|.|..||  |.||||:|.....|.|.||||.
  Fly     9 IIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLIN 73

  Fly    67 YRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQ-------TRSYRVVSIYRHKNY--IDFRNHDI 122
            ..||||:|||.:.:..|..||||.:.....|.:       |:.|.|..:::|:.|  .||.| ||
  Fly    74 QWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSN-DI 137

  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAH--YYKMPTTLQEMSL-RRV 184
            .:|:|:|:|.|..:|:||||..:..:|.:.:.|..|..||||..:.  ..|....|.|::| ||.
  Fly   138 GMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRP 202

  Fly   185 RNEYCGV-----PSLSICCWNPVQYACFGDSGGPLGSLVK-YGHKTIYVQFGVTNSVTGNCDGYS 243
            ||:...:     .|..||..|.....|.||||||.|..|. :|.|. :||.|:.:....||...|
  Fly   203 RNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKR-FVQMGIASFTYENCSKVS 266

  Fly   244 SYLDLMSYMPWLYQTLLRNW 263
            ...|::.|..|:.:.:  :|
  Fly   267 ILTDVVRYGRWIKKVV--DW 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 87/237 (37%)
Tryp_SPc 37..258 CDD:238113 88/240 (37%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 87/238 (37%)
Tryp_SPc 42..281 CDD:238113 88/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463375
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.740

Return to query results.
Submit another query.