DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and Sp212

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:245 Identity:62/245 - (25%)
Similarity:103/245 - (42%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PWMAYL----IRDNRFACGGSLIAYRFVLTAAHCT--KINDNLFVRLGEYDSSRTTDGQTRSYRV 105
            ||::.:    :|...|.|.||||:...|::||||.  ...|.:.|.||.||.....:.......|
  Fly   289 PWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNV 353

  Fly   106 VSIYRHKNY--IDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAH 168
            :.:..|.:|  ..:.:.|||::.::|.|.::..|.|||:......:::  |...| :.|||:   
  Fly   354 MRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTV--STTGF-IAGWGR--- 412

  Fly   169 YYKMPTTLQEMSLR----RVRNEYCGVPSLSICCWNPVQYA--------------CFGDSGGPLG 215
                    .|.|.|    ||.......|::....|......              |.|||||  |
  Fly   413 --------DEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGG--G 467

  Fly   216 SLVKYGHKTIYVQFGVTNS----VTGNC--DGYSSYLDLMSYMPWLYQTL 259
            .:||.|.:  ::..|:.::    ..|.|  :.|..|.||..::.|:.:.:
  Fly   468 LMVKQGDR--WLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 61/238 (26%)
Tryp_SPc 37..258 CDD:238113 62/242 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 62/242 (26%)
Tryp_SPc 277..511 CDD:214473 61/239 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.