DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG30323

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:318 Identity:70/318 - (22%)
Similarity:114/318 - (35%) Gaps:108/318 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTFLVILTLGSYGYSQ-----------LLDS--KCIALFRIRVIGGQNARRTPWMAYLIRDNRFA 59
            :.||::|.|.|..||.           :.|:  :.:...|.|    ::.|.  |     .||.| 
  Fly     1 MQFLLLLLLTSSAYSNEGKKGLQRNLYVTDNYHQNVVSIRTR----KHIRH--W-----GDNHF- 53

  Fly    60 CGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVV-------------SIYRH 111
            |.|||::..:|:|:..|.....         :|:.......::.|||             :||..
  Fly    54 CAGSLLSAWWVVTSGCCVSTRP---------ESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHV 109

  Fly   112 KNYIDFRN-----HDIAVLKLDRQVVYDAYIRPICILLNSGLQS--LANSIQNFTLTGWGQMAH- 168
            :..:...:     .::|:|||||.|....:   ..:|....|.|  |.||:      |||::.: 
  Fly   110 QKIVLDESAISGCTELALLKLDRGVTGQRF---AMMLPEKELNSTWLCNSL------GWGRIYYV 165

  Fly   169 --------------YYKMPTT----------LQEMSLRRVRNEYCGVPSLSIC-CWNPVQYA--- 205
                          .|..|.|          |.::..::: :||...|..|.| |.  ..|.   
  Fly   166 SYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKI-SEYECKPDCSRCLCM--TSYTGRG 227

  Fly   206 --CFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCD--GYSSYLDLMSYMPWLYQTL 259
              |..|.|.||     :....:|   ||...| ..||  |:..|.::.....::..||
  Fly   228 NMCQQDLGSPL-----FCDHFLY---GVARRV-HTCDDEGFMFYTNIYQNRKFIEDTL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 59/270 (22%)
Tryp_SPc 37..258 CDD:238113 58/273 (21%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 58/267 (22%)
Tryp_SPc 45..272 CDD:214473 58/264 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436711
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.