DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG30289

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:245 Identity:79/245 - (32%)
Similarity:124/245 - (50%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGG--QNARRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQ 99
            :.||  .|.:..|||. |:..:: .|||||||.:||||||||....| |:||||:|::.......
  Fly    42 IFGGAKTNIQENPWMV-LVWSSK-PCGGSLIARQFVLTAAHCVSFED-LYVRLGDYETLDPMPYC 103

  Fly   100 TRSYRVVSIYR--------HKNY--IDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANS 154
            ..::.:...|.        |:||  |..:| |||:|::...|.|..|:||||:|:...:|    |
  Fly   104 LNNHCIPKFYNISVDMKIVHENYNGITLQN-DIALLRMSEAVEYSDYVRPICLLVGEQMQ----S 163

  Fly   155 IQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYCGV------PSLSICCWNPVQYACFGDSGGP 213
            |..||:||||: ..|.:....|...:|..:...||.:      ....||..:.....|.||||||
  Fly   164 IPMFTVTGWGE-TEYGQFSRILLNATLYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGP 227

  Fly   214 LGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS--YLDLMSYMPWLYQTLLR 261
            |.|...||::.:..|:|:.:..:..|....:  |.::..:..|::..:::
  Fly   228 LSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWIFNKMVQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 78/236 (33%)
Tryp_SPc 37..258 CDD:238113 79/240 (33%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 78/237 (33%)
Tryp_SPc 42..271 CDD:238113 78/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
54.710

Return to query results.
Submit another query.