DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG30288

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:278 Identity:86/278 - (30%)
Similarity:130/278 - (46%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLLTFLVILTLGSYGYSQLLDSKCIAL----FRIRVIGGQNA--RRTPWMAYLIRDNRFACGGS 63
            ||...|:.|:...|   .:||::.|...    :|.|:.||::|  ...|||..::...:..||||
  Fly    10 IVACLFIGIIRTES---GRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGS 71

  Fly    64 LIAYRFVLTAAHCTK---INDNLFVRLGEYDSSRTTDG------QTRSYRVVSIYR---HKNYID 116
            ||..||||||.||..   :|    |||||||:......      ..|:|. |.:.|   |.|   
  Fly    72 LITARFVLTAEHCISPMYMN----VRLGEYDTRHPIFDCDDFVCTPRAYN-VDVDRKIVHSN--- 128

  Fly   117 FRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSL 181
             ..:||.:|::.|.|::..|:||||::|...|.....||..|..||||..:...:. ..||..:|
  Fly   129 -PGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQ-DRLQTATL 191

  Fly   182 RRVRNEYCGVPSLS-----ICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDG 241
            :::....|..|...     ||..:.:..:|.|||||||.::..:..:....||||.:.....|.|
  Fly   192 QQLPQWSCERPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSG 256

  Fly   242 YSSYLDLMSYMPWLYQTL 259
            ...|.::..:..|:...:
  Fly   257 LGIYTNVTHFTDWILDVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 76/236 (32%)
Tryp_SPc 37..258 CDD:238113 76/239 (32%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 76/237 (32%)
Tryp_SPc 45..270 CDD:238113 75/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.