DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG30287

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:277 Identity:93/277 - (33%)
Similarity:136/277 - (49%) Gaps:29/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIVLLTFLVILTLGSYGYSQLLDSKCI------ALFRIRVIGGQNAR--RTPWMAYLIRDNRFAC 60
            |:.||..:.::.|...|...|||.:|:      .|:  |||.|:.|.  ..|||..:|......|
  Fly     5 AVQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLY--RVINGKPADLFSNPWMVIIIERGMMKC 67

  Fly    61 GGSLIAYRFVLTAAHC-TKINDNLFVRLGEYDSSRTTD-------GQTRSYRVVSIYRHKNYIDF 117
            |||||..|:||||||| ::....|.||||:||.::..|       .:.|...|...|...:|.:|
  Fly    68 GGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNF 132

  Fly   118 RNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQN---FTLTGWGQMAHYYKMPTTLQEM 179
            |.:|||:|:|:..|.|...||.||:|:.....| :|.::|   |..||||:.......| .||:.
  Fly   133 RKNDIALLRLETTVQYGDNIRSICLLMGDYTWS-SNILKNLVKFNTTGWGRTESRINSP-VLQQA 195

  Fly   180 SLRRVRNEYCG------VPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGN 238
            ||......||.      :....||..:.....|.|||||||.:.|:.|.:...:.|||.:....:
  Fly   196 SLTHHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVH 260

  Fly   239 CDGYSSYLDLMSYMPWL 255
            |.|.:.|.:::.:..|:
  Fly   261 CFGPTVYTNVIHFANWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 82/236 (35%)
Tryp_SPc 37..258 CDD:238113 82/238 (34%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 82/237 (35%)
Tryp_SPc 42..280 CDD:238113 82/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.