DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG30286

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:285 Identity:87/285 - (30%)
Similarity:136/285 - (47%) Gaps:46/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLLTFLVILTLGSYGYSQLLDSKC-----IALFRIRVIGGQNAR------RTPWMAYLIRDNRF 58
            |:|||.|  |....:..:|.|:..|     .||        ||..      .:||||||.:....
  Fly     4 ILLLTSL--LPWHPHATAQFLEPDCGYMSPEAL--------QNEEHQAHISESPWMAYLHKSGEL 58

  Fly    59 ACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTD-------GQTRSYRVVSIYRHKNYI- 115
            .|||:|:.:||:||||||.:.::||.|||||::|..:.|       ..:..:.:...:||..|. 
  Fly    59 VCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSR 123

  Fly   116 DFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMS 180
            ..|.|||.:|:|.:.|.|..:|:|||::.|:.||.....:.....||||      :.|:......
  Fly   124 TNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWG------RSPSEAANHI 182

  Fly   181 LR--RVRNEYCGVPSLS---------ICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNS 234
            |:  ||.....||.|.:         ||..:....:|.||||||:|..::...:.::||.|:.:.
  Fly   183 LKSIRVTRVNWGVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSY 247

  Fly   235 VTGNCDGYSSYLDLMSYMPWLYQTL 259
            ....|...|.:.::|.::.|:...|
  Fly   248 GNAECLSPSVFTNVMEHIDWIMAAL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 74/242 (31%)
Tryp_SPc 37..258 CDD:238113 75/245 (31%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 73/235 (31%)
Tryp_SPc 39..268 CDD:214473 72/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463417
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.