DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG30088

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:242 Identity:79/242 - (32%)
Similarity:122/242 - (50%) Gaps:21/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RVIGGQNA--RRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDG 98
            |::.|:.|  :..|:||||...:...|||::|:.|::||||||  :...|.|||||:|.:|..|.
  Fly    44 RIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHC--MRPYLKVRLGEHDITRNPDC 106

  Fly    99 Q-------TRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQ 156
            |       ...:.:|...::|.:..|..:|||:|||.|.:.::.:|:|||::||   .:.|.::.
  Fly   107 QGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILN---PAAAPNVH 168

  Fly   157 NFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-GVPSLSI-----CCWNPVQYACFGDSGGPLG 215
            .|...||||....:. ...||...|.|..|.:| .|.|:.|     |........|.|||||||.
  Fly   169 EFQAFGWGQTETNHS-ANVLQTTVLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLV 232

  Fly   216 SLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSYMPWLYQTLLRN 262
            :.|.|.....|:|.|:.:.....|.....|..:.:|:.|:...:..|
  Fly   233 TKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYIRWIRYVMQSN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 77/232 (33%)
Tryp_SPc 37..258 CDD:238113 77/235 (33%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 77/233 (33%)
Tryp_SPc 45..273 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463396
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.640

Return to query results.
Submit another query.