DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG30087

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:262 Identity:82/262 - (31%)
Similarity:131/262 - (50%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SQLLDSKCIALFR----IRVIGGQNA--RRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKIN 80
            :|.|:..|...:.    :||:.|:.|  |..|:|.|:..::...||||::..|::||||||  :.
  Fly    23 AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHC--VF 85

  Fly    81 DNLFVRLGEYDSSRTTDGQ-------TRSYRVVSIYRHKNYIDFRNH--DIAVLKLDRQVVYDAY 136
            .||.:||||::.....|.|       :..|.::....|:.| :..||  |||:|||:|.:.::.:
  Fly    86 PNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFY-NAANHVNDIALLKLNRSINFNVH 149

  Fly   137 IRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYCG------VPSLS 195
            |:|||||||   .:.|.|:..:...|||: ......|..||...||.....||.      :....
  Fly   150 IQPICILLN---PASAPSVATYQTFGWGE-TKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQ 210

  Fly   196 ICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSYMPWLYQTLL 260
            ||..:..:..|.|||||||.:.|.:.....|:|.|:.:....:|.....|..:.:|:.|:.:.:|
  Fly   211 ICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIRRAML 275

  Fly   261 RN 262
            .|
  Fly   276 IN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 76/234 (32%)
Tryp_SPc 37..258 CDD:238113 76/237 (32%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 76/235 (32%)
Tryp_SPc 42..272 CDD:238113 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.840

Return to query results.
Submit another query.