DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG30002

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:272 Identity:90/272 - (33%)
Similarity:132/272 - (48%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YSQLLDSKC------IALFRIR--VIGGQNA--RRTPWMAYL--IRDNRFA-CGGSLIAYRFVLT 72
            |..|....|      |...|||  :.||:.:  ...||||:|  ..|.... ||||||:..||||
  Fly    38 YENLTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISELFVLT 102

  Fly    73 AAHCTKI---NDNLFVRLGEYDSSRTTDGQTRSYRVVS------------IYRHKNYIDFRNHDI 122
            ||||.|:   :..:.|.|||.|.|.|:|..|.:|..|.            |...:..:.:..:||
  Fly   103 AAHCFKMCPRSKEIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYDI 167

  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSI-QNFTLTGWGQMAHYYKMPTTLQEMSLRRVRN 186
            |::||:::||:..:|||||:.|...|.:....: |.|...|||:........:|::.    .:|.
  Fly   168 ALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGKTESLRYANSTMEV----DIRT 228

  Fly   187 EYC--GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCD-GYSS-YLD 247
            |.|  |..:..:|........|.|||||||........|...|||||.::.:.||. |:.: |:|
  Fly   229 EKCTDGRDTSFLCASGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQNCGAGHKAYYMD 293

  Fly   248 LMSYMPWLYQTL 259
            :.:||||:.:.:
  Fly   294 VPTYMPWILEKM 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 82/244 (34%)
Tryp_SPc 37..258 CDD:238113 83/245 (34%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 82/242 (34%)
Tryp_SPc 62..301 CDD:238113 82/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.