DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and T22A3.6

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:155 Identity:36/155 - (23%)
Similarity:46/155 - (29%) Gaps:64/155 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMP 173
            ||.|..:||::                  || |:..        :||.|.|.......:..|.|.
 Worm    98 YRGKKNVDFKD------------------RP-CLFW--------SSIPNSTFDISDSSSSSYSMN 135

  Fly   174 TTLQEMSLRRVRNEYCGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQF------GVT 232
            ..|.:        ||      ...|.||        ...|||.....|:.|....|      ..|
 Worm   136 RILPD--------EY------ENFCRNP--------DKNPLGPWCYVGNDTTAPCFQPCRPSTET 178

  Fly   233 NS--VTGNCDGY-------SSYLDL 248
            :|  |..|.||:       |..|||
 Worm   179 SSDFVCLNRDGFPYTDYDMSDILDL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 36/155 (23%)
Tryp_SPc 37..258 CDD:238113 36/155 (23%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 26/123 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.