DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and try-10

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:234 Identity:57/234 - (24%)
Similarity:97/234 - (41%) Gaps:48/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARRTPWMAYLIRDNRF------ACGGSLIAYR 68
            |:::|:..||..|              :|.|.:|.....::......||      .|||.|||..
 Worm    62 FILLLSFISYSTS--------------IINGFSANSFDTLSLASVITRFPDGTTNVCGGVLIAPS 112

  Fly    69 FVLTAAHCTKINDNLF----VRLGEYDSSRTTDGQT--RSYRVVSIYRHKNYIDFRNHDIAVLKL 127
            .|:|:|||....|:..    |.||:...::..||:.  ||:.:....:..|.....|.|:||:.|
 Worm   113 IVITSAHCVFSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSHAMAISKKFFNDASEANDDVAVIFL 177

  Fly   128 DRQ--VVYDAYIRPICILLNSG---------LQSLANSIQNFTLTGWGQMAH-YYKMPTTLQEM- 179
            .::  |.:......|..|.::|         |..|........:.|||:..: ..|...::::| 
 Worm   178 PQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETSVCYVAGWGKTENKTAKYSDSVRQMM 242

  Fly   180 ---SLRRV-RNEYCGVPSLSICCWNPVQYACFGDSGGPL 214
               |:||: :.:|....:::     ....||.||||.|:
 Worm   243 VNLSVRRIGKRKYLIAKAVT-----GSSRACMGDSGSPV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 52/208 (25%)
Tryp_SPc 37..258 CDD:238113 52/207 (25%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 52/207 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.