DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG43742

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:257 Identity:90/257 - (35%)
Similarity:135/257 - (52%) Gaps:10/257 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARRTPWMAYLIRDNRFACGGSLIAYRFVLTAAH 75
            ||.:.:....::||||..|......||..|..|..:.:||.|..::.|.||||||..::||||||
  Fly     9 LVAVVIYQNAFAQLLDENCKVKITYRVANGHTAITSQFMAALYNNSEFFCGGSLIHKQYVLTAAH 73

  Fly    76 CTKINDNLFVRLGEYDSSRTTDGQTRSYRV-VSIYRHKNYID--FRNHDIAVLKLDRQVVYDAYI 137
            |.:..|.:.|.|||.:.|..........|: ..:..|.|:..  |.| |||:|:|:|:|:::|:|
  Fly    74 CVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLN-DIALLRLEREVIFEAHI 137

  Fly   138 RPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYCGVPSLSICCWNPV 202
            |||||:|:..:.|  |:..|||..|||:..| ..:...|..:.|.|:....|.....:||..:..
  Fly   138 RPICIILDEDVTS--NNQNNFTAYGWGKTEH-GNISDVLSFIDLVRLPKSMCYQNINTICAGSTS 199

  Fly   203 QYACFGDSGGPL-GSLVKYGHKTIYVQFGVTNSVTGNCDG-YSSYLDLMSYMPWLYQTLLRN 262
            ...|..|||||| |:.|..| |:..:.||:|:.....|.| :..|.|:.:|..|:...:|.:
  Fly   200 GDTCESDSGGPLIGNFVHRG-KSRDILFGITSYGDAECSGLFGVYTDVNAYKSWIASVVLES 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 81/222 (36%)
Tryp_SPc 37..258 CDD:238113 81/225 (36%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 81/223 (36%)
Tryp_SPc 35..256 CDD:238113 81/225 (36%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.