DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG43110

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:262 Identity:87/262 - (33%)
Similarity:127/262 - (48%) Gaps:24/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLTFLVILTLGS--YGYSQLLDSKCIALFRIRVIGGQNA--RRTPWMAYLIRDNRFACGGSLIAY 67
            |..::.:.:|||  ..||..|...|......::|.|.||  :...:||.:.......|||::|..
  Fly     4 LFVWIFLCSLGSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHE 68

  Fly    68 RFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYID--FRNHDIAVLKLDRQ 130
            .||||.||| |....||||||.|:.:..||    ..||:....|..|.:  :.| |||::||:|.
  Fly    69 DFVLTVAHC-KSTQTLFVRLGAYNINHPTD----QIRVIETIAHPQYSNSTYAN-DIALVKLERS 127

  Fly   131 VVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYCGV---- 191
            |:::..|:||||.|::   :|...|:.:...|||:..: .:....||.:.:.|.....|.:    
  Fly   128 VIFNLNIQPICIHLDA---TLGKQIRYYNAFGWGRTRN-AEQSDILQRIFVNRTNPMICHLYLGM 188

  Fly   192 ---PSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSYMP 253
               |. .||........|.|||||||.|.:.|..|....|||:|:..|..|:|...|.|:..|..
  Fly   189 SPDPK-QICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSG 252

  Fly   254 WL 255
            |:
  Fly   253 WI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 78/228 (34%)
Tryp_SPc 37..258 CDD:238113 79/230 (34%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 78/229 (34%)
Tryp_SPc 36..257 CDD:238113 79/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463246
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.