DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG43125

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:287 Identity:67/287 - (23%)
Similarity:113/287 - (39%) Gaps:80/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTPAIVLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNA--RRTPWMAYLIRD--NRFACG 61
            |:..:.|..|.::|..  .|.:..|:..|          |:::  ...||:..:..:  :...|.
  Fly     1 MSATLRLAVFALLLFY--QGSALFLEQNC----------GKSSVFSPAPWLVKIRPELSSNITCT 53

  Fly    62 GSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYR---HKNY-IDFRNHDI 122
            |:||..|||||||.|......|.|||||.|.:.....:.: |..:.:.|   |::| .:...::|
  Fly    54 GTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQ-YEEIYVARALIHRSYSSESHQYNI 117

  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQ---------------------NFTLTGWGQM 166
            |:|:|...|||...|:||||.:|.|....|.:.:                     |:.|:.:|  
  Fly   118 ALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFG-- 180

  Fly   167 AHYYKMPTTLQEMSLRRVRNEYCGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGV 231
                          :|..|.:....|       .|:..      |.||...:  ....::.|:|:
  Fly   181 --------------VREPRPDVILPP-------QPIAV------GWPLTKQI--NESALFHQYGI 216

  Fly   232 ---TNSVTGNCDGYSSYLDLMSYMPWL 255
               .||.:..    ..|.|:|:|:.|:
  Fly   217 LSHRNSESKK----DVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 59/249 (24%)
Tryp_SPc 37..258 CDD:238113 60/251 (24%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 35/100 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.