DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG42694

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:265 Identity:77/265 - (29%)
Similarity:129/265 - (48%) Gaps:16/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLTFLVILT-LGSYGYSQLLDSKCIALFRIRVIGGQNARRTPWMAYLIRDNRFACGGSLIAYRFV 70
            |..:|::|| |.|:..|:.||..|.|....:.|......:..|:|::.......|.||||:.:||
  Fly     4 LFAWLLMLTVLQSHVNSKFLDDYCGAPISNQSITKLRQPQAGWLAHISNGTHVLCSGSLISKQFV 68

  Fly    71 LTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDA 135
            |:||.|..::..|||:||..:::::....|.|..|:..:..|..    ..||.:|||.:.|.|:.
  Fly    69 LSAAQCIDVHGKLFVQLGVSNATKSPHWYTVSNVVIPSHSGKRL----QRDIGLLKLSQSVDYND 129

  Fly   136 YIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTT--LQEMSLRRVRNEYCGVPSLSICC 198
            ::.||||.||:....:...:||||.:.|   ....|.|.|  |.::|..|.:....|..:....|
  Fly   130 FVYPICIALNTNTLDMVKILQNFTTSAW---LSKNKNPQTIVLSQLSRDRCKLNLSGNVTPKEIC 191

  Fly   199 WNPVQ--YACFGDSGGPLGSLVKYGHKTI-YVQFGVTNSVTGN--CDGYSSYLDLMSYMPWLYQT 258
            ...:|  .:||.|||..|...:..|...: .:.||:...|.|.  |...:.|:|:...:.|: :|
  Fly   192 AASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSEPAIYIDVAECVGWI-ET 255

  Fly   259 LLRNW 263
            :::.:
  Fly   256 VVQQY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 64/224 (29%)
Tryp_SPc 37..258 CDD:238113 65/227 (29%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 64/217 (29%)
Tryp_SPc 46..253 CDD:214473 63/213 (30%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.