DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and cel.2

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001020344.2 Gene:cel.2 / 565117 ZFINID:ZDB-GENE-061110-10 Length:551 Species:Danio rerio


Alignment Length:45 Identity:11/45 - (24%)
Similarity:17/45 - (37%) Gaps:17/45 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 CFRPLFDKSNNTDVEVETLDAKIQGQRCNCDKLLLSTEPPVPVVY 166
            |.|       .||.:..||..|::          |:|....|:|:
Zfish   273 CLR-------RTDPKAVTLAGKVR----------LATSATEPIVH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
cel.2NP_001020344.2 COesterase 26..539 CDD:395084 11/45 (24%)

Return to query results.
Submit another query.