DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and LOC4576532

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_556011.3 Gene:LOC4576532 / 4576532 VectorBaseID:AGAMI1_011044 Length:564 Species:Anopheles gambiae


Alignment Length:84 Identity:20/84 - (23%)
Similarity:32/84 - (38%) Gaps:21/84 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TDVEVETLD---------AKIQGQRCNCDKLLL--STEPPVPVVYFDKNY-------IGNVSSET 179
            |:.|::.:|         ||....|....:|.|  ||:   .:|:.:.||       ...||.|.
Mosquito   481 TEEEMQVVDRFVTMYEHFAKGDQPRFGAYELPLQDSTD---KLVFLELNYPQSKTVRAEGVSDEP 542

  Fly   180 ILNTIEFLESFLPPPTKKH 198
            ...|::|.:.....|...|
Mosquito   543 YWKTLDFNDGPYASPAPTH 561

Return to query results.
Submit another query.