DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and CG4757

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_650043.1 Gene:CG4757 / 41330 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster


Alignment Length:108 Identity:22/108 - (20%)
Similarity:35/108 - (32%) Gaps:49/108 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 HQRTFLHLFHVPYIICF--------------------YAAKGKWPYVPGFMKYRVDNAARSFFNQ 104
            |....::||||..:|..                    :|.||. |:                 |:
  Fly   452 HHDELIYLFHVGLLIPLLKREDPENFMIELLTRMWIEFAQKGD-PH-----------------NK 498

  Fly   105 NDSFIKQFCTKWIQVKECFRPLFDKSNNTDVEV-ETLDAKIQG 146
            ||.::|..  .|        ||::..:...:|: ..|.||..|
  Fly   499 NDEYLKGL--NW--------PLYNAQDKGYLEIGNNLTAKSGG 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
CG4757NP_650043.1 COesterase 20..540 CDD:395084 22/108 (20%)

Return to query results.
Submit another query.