DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and alpha-Est6

DIOPT Version :9

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_524262.1 Gene:alpha-Est6 / 40902 FlyBaseID:FBgn0015574 Length:568 Species:Drosophila melanogaster


Alignment Length:175 Identity:37/175 - (21%)
Similarity:63/175 - (36%) Gaps:62/175 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RKIALHILPLFLAIFLFTMGEAYLKSVRVDEIPFAGRKALANRRSSGIHLISSLEHQRTFLHLFH 69
            |.:.|...|.|......:.|:|..|.|::.    .|  ::..||.|||                 
  Fly    17 RFLILRCCPGFKRFSCQSAGDADSKVVKLS----VG--SVKGRRLSGI----------------- 58

  Fly    70 VPYIICFYAAKGKWPYVPGFMKYRVDNAARSFFNQNDSFI-KQFCTKW---IQVKECFRPLFDKS 130
              |...||:.:|    :| |.|..:..|         .|: .|....|   :..:: .||:    
  Fly    59 --YGDEFYSFEG----IP-FAKPPLGKA---------RFVASQLADPWNSELDARQ-ERPI---- 102

  Fly   131 NNTDVEVETLDAKIQGQRCNCDKLLLS--------TEPPVPVVYF 167
               .::::....|:.|..   |.|.|:        :|||:||:.:
  Fly   103 ---PLQMDRRSGKVVGSE---DCLYLNVYTKHFNESEPPLPVMVY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
alpha-Est6NP_524262.1 COesterase 35..534 CDD:278561 33/157 (21%)
Aes <133..325 CDD:223730 5/9 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.