powered by:
Protein Alignment CG30095 and alpha-Est10
DIOPT Version :9
Sequence 1: | NP_725529.1 |
Gene: | CG30095 / 246453 |
FlyBaseID: | FBgn0050095 |
Length: | 214 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246962.1 |
Gene: | alpha-Est10 / 40896 |
FlyBaseID: | FBgn0015569 |
Length: | 581 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 14/47 - (29%) |
Similarity: | 20/47 - (42%) |
Gaps: | 9/47 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 NCDKLL-----LSTEPPVPVVY---FDKNYIGNVSSETILNTIEFLE 188
||..|| |:.:|.:...| ..|.|.|:..... .|.::|||
Fly 387 NCKNLLPSDLGLNLDPKLRENYGLQLKKAYFGDEPCNQ-ANMMKFLE 432
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30095 | NP_725529.1 |
None |
alpha-Est10 | NP_001246962.1 |
COesterase |
49..542 |
CDD:278561 |
14/47 (30%) |
Aes |
<132..>279 |
CDD:223730 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1516 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.