DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Jhedup

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster


Alignment Length:93 Identity:21/93 - (22%)
Similarity:38/93 - (40%) Gaps:18/93 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VPYIICFYAAKGKWPYVPGFMKYRVDNAARSFFNQNDSFIKQFCTKWIQVKECFRPLFDKSNNTD 134
            :|:|:...:..|:....  .|:..::...|:.||:|  |::....           |.:....|.
  Fly   330 MPWILSLSSRAGEGSLF--IMRAFINPKLRAEFNEN--FLEHMAL-----------LLNLPEGTP 379

  Fly   135 VEV--ETLDA-KIQGQRCNCDKLLLSTE 159
            |::  |.||| ..:|...|.|.:|...|
  Fly   380 VQMVSEILDAYDFKGDSLNNDTMLKLAE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
JhedupNP_611085.2 alpha/beta hydrolases 31..508 CDD:473884 21/93 (23%)

Return to query results.
Submit another query.