DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and CG3841

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_609300.1 Gene:CG3841 / 34278 FlyBaseID:FBgn0032131 Length:564 Species:Drosophila melanogaster


Alignment Length:142 Identity:31/142 - (21%)
Similarity:49/142 - (34%) Gaps:47/142 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSGIHLISSLEHQRTFLHLFHVPYIICFYAAKGKWPYVPGFMKYRVDNAARSFFNQNDSFIKQFC 113
            ::.:|    ||:|    ||.|                  .|....||.|...|..::|:      
  Fly   335 NANVH----LENQ----HLLH------------------DFASNFVDYAPELFLYRHDA------ 367

  Fly   114 TKWIQVKECFRPLFDKSNNTDVEVETL--------DAKIQGQRCNCDKLLLSTEPPVPVVYFDKN 170
                |:.|..:..:...|.|::..|.:        ||.| |.  ...:|:.......||.|...:
  Fly   368 ----QIGEKLKDFYLGDNTTEINSENIENFGQIFSDAYI-GH--GVHRLVQLASHFTPVYYTRMD 425

  Fly   171 YIGNVSSETILN 182
            |:|:.|....||
  Fly   426 YVGDQSLSAPLN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
CG3841NP_609300.1 COesterase 27..528 CDD:395084 31/142 (22%)

Return to query results.
Submit another query.